PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g099080.1
Common NameMTR_3g099080
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family SBP
Protein Properties Length: 377aa    MW: 41747.4 Da    PI: 7.2097
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g099080.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1277.3e-4098174278
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      C v+gC++dls++++yhrrhkvCe hsk+p+v++ gl+qrfCqqCsrfh+l++fDe+krsCr+rL++hn+rrrk+q+
  Medtr3g099080.1  98 CLVDGCNSDLSNCRDYHRRHKVCELHSKTPEVTICGLKQRFCQQCSRFHSLEQFDERKRSCRKRLDGHNRRRRKPQP 174
                      **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.1E-3194159IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.46295172IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.14E-3796177IPR004333Transcription factor, SBP-box
PfamPF031104.0E-2998171IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MEWNLKAPSW DLGGIEEATL PNIETMEESN RFGVYKMKGE FSVDLKLGQV GNSATDQSPL  60
PLSNDAVVVS KIATPTSSSG SSKRARAMNN NTTLTVSCLV DGCNSDLSNC RDYHRRHKVC  120
ELHSKTPEVT ICGLKQRFCQ QCSRFHSLEQ FDERKRSCRK RLDGHNRRRR KPQPEPITRP  180
AGSFLSNYQG TQLLPFSSST TMVNSTWSSG LISSCESGRL HINNQHQQVH VVDKQDHFLG  240
STATTYEGKQ LQFLHNDNNN PSLHNETAPL LRTSSKMFCD SLATSVHESP CALSLLSSSQ  300
TRIPDNGLNQ MVQQPHSMSH MQPLGLSLHG NNSFESMEGV LVPNGSESDH CSSLYNMGSD  360
GSQGNDAPQL FPYQWE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-28981711184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1153170RKRSCRKRLDGHNRRRRK
2153171RKRSCRKRLDGHNRRRRKP
3154171KRSCRKRLDGHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT9542520.0CT954252.6 M.truncatula DNA sequence from clone MTH2-60M21 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003602795.10.0squamosa promoter-binding 13A-like protein
TrEMBLG7J3V10.0G7J3V1_MEDTR; Squamosa promoter-binding 13A-like protein
STRINGGLYMA05G38180.101e-142(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25913378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.13e-68SBP family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Aung B, et al.
    MicroRNA156 as a promising tool for alfalfa improvement.
    Plant Biotechnol. J., 2015. 13(6): p. 779-90
    [PMID:25532560]